SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001233 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001233
Domain Number 1 Region: 1-295,399-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-63
Family FAD-linked reductases, N-terminal domain 0.00000000212
Further Details:      
 
Domain Number 2 Region: 275-385
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.64e-36
Family L-aminoacid/polyamine oxidase 0.000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001233   Gene: ENSOCUG00000001429   Transcript: ENSOCUT00000001433
Sequence length 503
Comment pep:novel chromosome:oryCun2:X:29108019:29153534:1 gene:ENSOCUG00000001429 transcript:ENSOCUT00000001433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLAAAKLLSEYDVNVLVLEARDRVGGRTYTVRNKHVNYVDVGGAYVGPTQNRILRLSKEL
GLETYKINVNERLVQYVKGKTYPFRGAFPPVWNPVAYLDYNNLWRTMDSMGKEISLLLTF
KSVHRDWLQKQFVRDLKVLICMNRTARHFAYLFVNINVTSEPHEVSALWFLWYVKQCGGT
TRIFSITNGGQERKFIGGSGQVSERIMDLLGDRVKLKCPVTYVDQTNDNIVVETLNHETY
ECKYVLSAIPPTLTAKIHFKPELPPERNQLIQRLPMGAIIKCMMYYKEAFWKKKDYCGCM
IIEDEEAPISITLDDTKPDGSLPAIMGFIVARKADRLAKLHKEIRKRKICELYARVLGSE
EALQPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIYFAGTETATQWSGY
MEGAVEAGERAAREILNALGKVAKKDIWVPEPESQDVPSLEIKPTFLERNLPSVPGLLKI
IGVSTSVTTLCLVLYKWKLLPRP
Download sequence
Identical sequences 9986.ENSOCUP00000001233 ENSOCUP00000001233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]