SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001440 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001440
Domain Number 1 Region: 77-386,493-528
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.92e-67
Family FAD-linked reductases, N-terminal domain 0.00000108
Further Details:      
 
Domain Number 2 Region: 367-479
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.29e-32
Family L-aminoacid/polyamine oxidase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001440   Gene: ENSOCUG00000001679   Transcript: ENSOCUT00000001681
Sequence length 530
Comment pep:novel chromosome:oryCun2:13:123686278:123691626:1 gene:ENSOCUG00000001679 transcript:ENSOCUT00000001681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPVATFIPGRQAGHRARALERPTPLLSLLTGILILGLLLAAPSCLGYFEDLAKCFQDPDY
DSFLLTAQEGLHASPLPKRVVVVGAGMSGLAAAKTLQDAGHQVTVLEASNHIGGRVITMR
NKEEGWHCELGPMRIPKSHRLVHTYVKKLGLKLNKFIQYDDNTWYLINGQRYRAREVKAN
PELLGYSVKPTEKGKSAMTLFHQSISKLRQNLKMFNCSHLMSLYDSYSTKAYLLKEGMLS
RGAVKMIGDVMNEEAGYYKSLLESLRTGIIFSQSEDFSEIIGGFDQLPYALSATLKPGTI
HLGSKVETVVRDGSEVQVSYRAGEPSSELRKLTADYVLISASAKATRLITFRPPLSADKM
DALRSVHYTSATKVVLACDERFWERDGIRGGVSITDRPSRYIHYPSHQLPSGKGILLASY
TVDDDSLFLTAMTREQVVDLVLDDLAAVHRIPKEELRHMCPSSVVKHWSLDPLTIGAFAE
FTPYQFVDYSRQLFQPEGRIHFAGEHTCLPHAWMDTAIKSGLQAARNIQA
Download sequence
Identical sequences G1SFW8
9986.ENSOCUP00000001440 ENSOCUP00000001440 ENSOCUP00000001440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]