SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002001 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002001
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-22
Family Kringle modules 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002001   Gene: ENSOCUG00000002320   Transcript: ENSOCUT00000002320
Sequence length 263
Comment pep:novel chromosome:oryCun2:21:3729628:3740289:-1 gene:ENSOCUG00000002320 transcript:ENSOCUT00000002320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLAWVQTFVLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLHCLNWLDAQGALASGP
ESGAGNHNYCRNPDHDPRGPWCYVSGQTGAPEKRPCEDLRCPETTSLGPPASTVEMAEAP
DAPGEDEAQAFPPAKALPARSEAAAVQPAVGIGQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGTGIILGYTYKRGKDLKAQHEQKACEREMQRITLPLSAFTNPTCEIVDEKTIVVHA
SQTPVDLQEGSTPLMGQAGTPGA
Download sequence
Identical sequences 9986.ENSOCUP00000002001 ENSOCUP00000002001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]