SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002088 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002088
Domain Number 1 Region: 161-303
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.49e-26
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 14-123
Classification Level Classification E-value
Superfamily DEATH domain 4.12e-25
Family DEATH domain, DD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002088   Gene: ENSOCUG00000002417   Transcript: ENSOCUT00000002415
Sequence length 305
Comment pep:novel scaffold:oryCun2:GL019127:74814:76662:1 gene:ENSOCUG00000002417 transcript:ENSOCUT00000002415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAAGGPDLSSEPPARSASSLPLAALNVRVRRRLALFLNVRTQVAADWSALAEEMGFEYL
EIRQLETRPDPTGSLLDAWQSRPGASVGRLLELLEALGRDDVLAELRPSIEEDCQKYIWK
QQQEESEKPLQVAVVGSSVPRTPELAGITTLDDPLGQVPERFDAFICYCPSDMQFVQEMI
RQLEQTNYRLKLCVSDRDVLPGACVWSIASELIEKRCVRHVHGWCRRMVVVVSDDYLQSK
ECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAK
ALSLP
Download sequence
Identical sequences G1SHI2
9986.ENSOCUP00000002088 ENSOCUP00000002088 ENSOCUP00000002088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]