SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002538 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002538
Domain Number 1 Region: 478-608
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.31e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000021
Further Details:      
 
Domain Number 2 Region: 126-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.27e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000409
Further Details:      
 
Domain Number 3 Region: 299-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.56e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002538   Gene: ENSOCUG00000002920   Transcript: ENSOCUT00000002923
Sequence length 613
Comment pep:novel chromosome:oryCun2:X:104530666:104566241:-1 gene:ENSOCUG00000002920 transcript:ENSOCUT00000002923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTIGAGAYAYKTIKDDKKRYDERMSGLGLTPEEKQKRATASAPEG
EPVSQVRVPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRG
NMVKLNDGSQITYEKCLIATGGTPRNLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREV
KSITIIGGGFLGSELACALGRKARASGKEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSGGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDSPKSATEQSGTGIRSESETELEASE
ITIPPSTPGVPQAPAQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Download sequence
Identical sequences G1SIM3
XP_002720337.1.1745 ENSOCUP00000002538 ENSOCUP00000002538 9986.ENSOCUP00000002538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]