SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002551 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002551
Domain Number 1 Region: 2-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.85e-67
Family Ankyrin repeat 0.0000243
Further Details:      
 
Domain Number 2 Region: 312-415
Classification Level Classification E-value
Superfamily DEATH domain 4.37e-18
Family DEATH domain, DD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002551   Gene: ENSOCUG00000002937   Transcript: ENSOCUT00000002936
Sequence length 422
Comment pep:novel scaffold:oryCun2:GL018855:577338:613366:-1 gene:ENSOCUG00000002937 transcript:ENSOCUT00000002936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVMHLAAWSGSLETTLMLVRAGADQRATTQDGMNALHFAAQSNNVPVVEYLIQDLHLSD
LNQADKRGRKPFLCAAERGHVEVIETLTLLNLHSSEKDKEGNTALHLAARGGHSRAVQLL
LTQRRGVDEVNEDGETPFFLSVQGGHEECSQVLLEAGSDINVRNKLNVSALQTAARNGQA
SLVKFLLRENVDLHQGLDPTESPLHLAVTHNHMAIVTSLLQAQHDTNVLNQRQQTPLHVA
ADLGDVELVETLLQAGCDLKAVDKQGRTALAVAARSGHSLVVDMLIKAERFCAWRQEHGE
GPRAPLTFKQDHSLETRPVRALLWDLAYRQLSANEWQRLARSWGFTEEQIRAIEQQWAGK
ESFREHGHRALLIWLHGALLTQPHPAKHLHETLVRAGFPELAEKTRQFKNDSDSCSRKCA
VS
Download sequence
Identical sequences ENSOCUP00000002551 9986.ENSOCUP00000002551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]