SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003050 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003050
Domain Number 1 Region: 24-122
Classification Level Classification E-value
Superfamily DEATH domain 4.52e-21
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000003050
Domain Number - Region: 287-420
Classification Level Classification E-value
Superfamily Tropomyosin 0.00017
Family Tropomyosin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003050   Gene: ENSOCUG00000003517   Transcript: ENSOCUT00000003516
Sequence length 998
Comment pep:novel scaffold:oryCun2:GL018973:239243:262990:-1 gene:ENSOCUG00000003517 transcript:ENSOCUT00000003516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRAEAGEAEEEAGAGSGSEAEEDALWERIEGVRHRLTRALNPAKLTPYLRQCRVIDEQ
DEEEVLSTYRFPCRVNRTGRLMDILRCRGKRGYEAFLEALEFYYPEHFTLLTGQEPAQRC
SMILDEEGPEGLTQFLMTEVRRLRDARKRCQRLREDWEAGSLELLRLKDENYMIAMRLAQ
LSEEKNSAVLRSRDLQLAVDQLKLQGEAEEECTLLRRARGPPPPPPSGAWAQALETTVRP
WALDGWVSLLFGKVGPGPAAEAVLNPDPQEASRPGAPGSERILLDILEHDWREAQDSRQE
LCQKLLAVQGELQWAEELRDKYLQEMEDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKE
RDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTLTSLEGAKALLEAQLQRA
QGGSCLKACASSHSLCSNLSSTWSLSEFPSPLGVPEAAGDVAGTGGSEPLTSEEATDSEK
EINRLSILPFPPSAGSILRRQREEDPAPPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDS
VWPLGKPEGPATRGGGLDLINRSLAIRVSGWSPPGGPESPDRGPDCLSLLGDRWSGAVVR
RVLSGPGSARTEPRELRAEAAGQEGACLEAESQQRTLPWSQGSTLPFLGDSKACQSFHEA
LDAWAKGPGAEPFYIRANLTLPERADPHALCVKAQEILRLVDPAYKRRQEWFCTRVDPLT
LRDLDRGTVPNYQRAQQLLEVQEKCLPSSRHRSPRNNLKKRALDQLRLVRPKPVGGPAGD
CPEQLLVEPCSEPERSLKPYSLVRPLLVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQ
VCPAESLSGDEQCTPSAPGAPKARPATPGLGSRIRAIQESVGKKHCLLELGARGVRELVH
NDIYPIVIHVEVTEKNIREVRGLLGRPGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHAW
AHAEELAKVVRGRILQEQARLVWVERGSSRGCQSSSEA
Download sequence
Identical sequences G1SJV8
ENSOCUP00000003050 ENSOCUP00000003050 9986.ENSOCUP00000003050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]