SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003069 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003069
Domain Number 1 Region: 434-825
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.96e-130
Family Ankyrin repeat 0.000000000211
Further Details:      
 
Domain Number 2 Region: 85-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.19e-109
Family Ankyrin repeat 0.000000136
Further Details:      
 
Domain Number 3 Region: 4068-4178
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-26
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003069   Gene: ENSOCUG00000003521   Transcript: ENSOCUT00000003541
Sequence length 4363
Comment pep:known chromosome:oryCun2:18:25810056:26164974:1 gene:ENSOCUG00000003521 transcript:ENSOCUT00000003541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEETEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
RGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTP
LHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAQKNQMDIATTLLEYGADANAVT
RQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGA
HVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINV
LLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETITTTTITEKHKMNVPETMN
EVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAEG
YMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLR
HYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRIT
CRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR
SENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIK
QESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSP
IVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDIT
GTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMN
DPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQ
QLVFNFYAFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKK
ETESDQDDEAEKADRRQSFASLALRKRYSYLTEPGMIERSAGATRSLPTTYSYKPFFSTR
PYQSWTTAPNTVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSV
KSISDVASPIRSFRTISSPIKTVVSQSPYNLQVSSGTLVRPPTVTEATPLKGLASNSTFS
SRTSPVTTGGSLLERSSITMTPPASPKSNLNMYSSSLPFKSIITSATPLISSPLKSAVAP
AQSAVDVISSAKVTMASALSSPLKQMPGHAEVALVNGSVSPLKYPSSSTLINGCKATATL
QDKISTATNSVVNAATDTVDKVFATTTAMPFSPLRSYVPAAAPSAFPSLRTPSASALYTS
LGSSLSATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSLTKSAAALLSPIKTLTTET
RPQPHFNRTSSPVKSSLFLTPSSLKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQTDV
PEEKPFPPELPREGRMEDEEPFKIVEKVKEDLVKVSEILKKDVCVDDKGSPKSPKSDQGR
SPEEDWTEFSSEEIREARQAAASHAPSLPERVQVKAKAASEKDYNLTKVIDYLTNDIGSG
SLTNLKYKFEDAKKDGEERQKRILKPAMALQEHKLKMPPASVRPSTSEKELCKMADSFFG
TDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVITE
TRTEVVHVIRSYEPSAGEAPQSQPEEPGSPKPSPTFTELEPKPAPSSIKEKVKAFQMKAN
GEDEEPSRVLGKGVRVKEETHITTTTRMVYHSPPGSEGSSERIEETMSVHDIMKAFQSGR
DPSKELAGLFEHKSAVSPDGHRCAAEASAQHAEKDSQMKPKLERIIEVHIEKGNQAEPTE
VIIRETKKHPEKEMYVFQKDLPRGDINLKDFLPEKHDAFPCPEEQGQQEEEELTAEESLP
SYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGESYRFA
EKMLLSDKLDVSHSDTEESSSELQGSDKRAREKVATAPKKEILSKIYKDVSENGVGKVSK
DEHFDKVTVLHYPGDVGSPKHAMWMRFTEDRLDRGREKLIYEDRVDRTVKEAEEKLTEVS
QFFRDKTEKLNDELQSPEKKPRPRNGKEYSAQSPEKGLLTELLASNEEWVKARQHGHDGA
GFPRAEERRAPGVSPEKPALLPPHAGDGKPPEETRGGVAQSKAPEGPQSGFQLKQSKLSS
IRLKFEQGAHIKSKDVCDEDKRPDGQSRIPVKKLQESRLPVHQAFAREKQQKGGTDLADQ
SGSVQNGALVSKAKDEAAQGGDVVVNDVGSDEATIQRTETPSKAMPERFSGHQAADLACP
VTSDLATAKGPWDKKVFRTWESSGASYNKSQKEKLSHVLVHDVRESHLGHPESQSVAQKN
EFLSVTEREHRVLTNGSLSEIKEMTVKSPSKKVLYREYVVTDGDRPGGPPEQPARRGESP
AVSHGPVRMAEERNGLPANGPHAFCEPAALPKHAPSPKLSQSSLSKETVETKHFNSIEDA
KVTYSEISKVSKQSYVGLCPPLEEPETSPTKSPDSLEFSPGQESPSSDVFDHSPMDGLEK
LAPLAQTEGGKEIKTLPVYVSFVQVGKQYEKEIQQGSVKKIISQECKTVQETRGTFYTSR
QPKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYEFTSKTPDSLIAFIPGK
PSPIPEVSEESEEEEQAKSTSLKQPAAEETPVAREMPNEVGRDSSQRPKTNRVAYIEFPP
PPPLDAEQLESEKQPYRPEKEGELIEVSLQDEHDKYQLAEPVIRVQPPSPVPPGADVSDS
SDDESIYQPVPVKKYTFKLKEVDDDQKEMTKCKAAAAKAGNQKESESNGSAKENDFGLPL
DSPQNETAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDLQDEDDGLTESDSKLP
SQTMEIKKDVWNTEGILKPADRSFSQSKLEVIEEEGKVGPEEEKPCTQSPSSGKTADKTE
QKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWSNNRGDDEVF
DSKSRDDDTKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNPFPFHEGKMFEMTRSG
AIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDETMVTATPQPQAGDTAVETNLERNV
EAPPVEPPPSIPTSGEGQEDTSGSGSLERAAAAATSTSKVDPKLRTPIKMGISASTMTMK
KEGPAEVPDKLEAVATSCQGLEHEALSMTANAASSQMGVRPQERHDFQKDNFNNNNNLDA
STMHTDHMTSHVVLPEHSAPRCATEKAKPVKGSSGKKPGLPHGHCTKDKQKVLGEQQRTK
ESIGIRRQSKLPIKATAPKDNLPPNHMPNLKASKTKQVSPPGKTTTLPSSSCVDGKSRIP
VKHTHRDNTVSVRKACATQKQEQPEKDKAKQLPSKLPVKVRSTCVTTTTTTTTTTTTTTT
TTSTTTVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEDRKMQSEVSDEEESTSRN
TSLSETSRAGKPSVTTKSARDKNTEAAPLKSKSEKAGSERRSSRRTGPQSPCERTDIRMA
IVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALT
SVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGWQNETSGGNVESPAQA
RRIAGGLLDRLDDSPDQCRDSITSYLKGEPGQFEANGSHAEVTPEAKTKSYFPESQNDIG
KQSAKEILKPKIHGSGRVEEPASPLAAYQKSLEETSKLVIEEPKPCVPVSMKKMSSRTCP
AHGKPRLNLHEEEGSSGSEQKQGEAYKVKAKKEVRPVEKKSYS
Download sequence
Identical sequences G1SJX5
ENSOCUP00000003069 9986.ENSOCUP00000003069 ENSOCUP00000003069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]