SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003642 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003642
Domain Number 1 Region: 225-291
Classification Level Classification E-value
Superfamily Homeodomain-like 1.92e-23
Family Homeodomain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000003642
Domain Number - Region: 73-138
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000233
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003642   Gene: ENSOCUG00000004213   Transcript: ENSOCUT00000004211
Sequence length 387
Comment pep:novel chromosome:oryCun2:13:73673256:73678046:1 gene:ENSOCUG00000004213 transcript:ENSOCUT00000004211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVG
TAPSSPISVTMEPPEPHLVGDGPQHHHHLHHSQQPPPPAAAPTQTLQPSPQQQAPPPPQQ
PPPPAQQLGTAASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQEGNAAHE
SFRPKLEQEDSKTKLDKREDSQGDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFS
DHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAE
AGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRV
LIHGLGPGGQPALNPLSNPIPGTPHPR
Download sequence
Identical sequences G1SLB0
9986.ENSOCUP00000003642 ENSOCUP00000003642 ENSOCUP00000003642 XP_002715913.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]