SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003881 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003881
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-22
Family Pyrin domain, PYD 0.0000238
Further Details:      
 
Domain Number 2 Region: 110-194
Classification Level Classification E-value
Superfamily DEATH domain 3.02e-18
Family Caspase recruitment domain, CARD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003881   Gene: ENSOCUG00000004495   Transcript: ENSOCUT00000004494
Sequence length 196
Comment pep:novel scaffold:oryCun2:GL018752:1101459:1102532:1 gene:ENSOCUG00000004495 transcript:ENSOCUT00000004494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRARDAILEALENLTADEFKKFKHKLLSVPLREGYGRIPRGTLLSMDAVDLTDKLVSFY
LETYGAELTAAVLRDMGMQESAEQLEELLSQGSGAAPAAGIKAHSEKIAKPALHFVDQHR
AALISRVTDVDGVLDVLHGRVLTEEQYQAVRAETTNPNKMRKLFSFAPAWDLTCKDLLLQ
ALRDTQPYLVADLEPR
Download sequence
Identical sequences G1SLX6
ENSOCUP00000003881 ENSOCUP00000003881 XP_002721796.1.1745 9986.ENSOCUP00000003881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]