SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003917 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003917
Domain Number 1 Region: 12-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.64e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003917   Gene: ENSOCUG00000004543   Transcript: ENSOCUT00000004539
Sequence length 374
Comment pep:novel chromosome:oryCun2:18:16795637:16805914:1 gene:ENSOCUG00000004543 transcript:ENSOCUT00000004539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQVSVDTGALHVVIVGGGFGGIAAASQLQALNVPFLLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKDNFRQGRVVGIDLKNQTVLLQGGEALPYSHLILATGSSGPFPGKLN
EVSCQQAAIQAYEDMVQQVQRSEFVVVVGGGSAGVEMAAEIKTEYPNKEVTLIHSQVTLA
DKELLPSVRQEVKEILLRKGVRLLLGERVSNLEELPLNEYRDYIKVQTDQGTEVATNLVI
LCNGIKVNSSAYHSALESRLAGNGALRVNEHLQVEGCSHVYAIGDCADVKEPKMAYHAGL
HAGVAVANIINSTRQRPLKVYKPAGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDL
FVSTSWKTMKQSPP
Download sequence
Identical sequences 9986.ENSOCUP00000003917 ENSOCUP00000003917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]