SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003936 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003936
Domain Number 1 Region: 433-746
Classification Level Classification E-value
Superfamily L domain-like 1.43e-61
Family Internalin LRR domain 0.0095
Further Details:      
 
Domain Number 2 Region: 143-451
Classification Level Classification E-value
Superfamily L domain-like 3.06e-56
Family Internalin LRR domain 0.061
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000003936
Domain Number - Region: 762-852
Classification Level Classification E-value
Superfamily DEATH domain 0.0424
Family DEATH domain, DD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003936   Gene: ENSOCUG00000004559   Transcript: ENSOCUT00000004562
Sequence length 862
Comment pep:novel chromosome:oryCun2:10:36603305:36618095:1 gene:ENSOCUG00000004559 transcript:ENSOCUT00000004562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKEGSSEEPEDRTGQLRKGSRSLSVEEPGFSKGTADVSQEASDALEEKPSSPIYAPAP
GRGTLDSASSSGSKPKGDEETNRQVSEASPGDASPRSKPETAQNSSSSVNETTDSQVSAD
LLPCPQIPEENQQGLDLELDNFTVHLEAKGLQEFPQDILKIKYVKYLYLEKNQIRTFQGT
DPGDLRGLEILSLQENELSSLPPEIQLLHNLRILNVSHNQIAHIPKELSQLGNIRQLFLN
NNYIETFLSDLESLGNLEILSLGRNKMRHIPDTLPSLKNLKVLSLEYNQLTIFPKSLCFL
PKLISLNLTGNLIESLPKEIRELKHLEKLFLDHNKLTFLAVEMFQLFKIKELQLADNKLE
LISHKIENFKELRVLILDKNLLKNIPEKISSCGMLECLSLSDNKLSDLPKTIYKLKNLRK
LHVNRNNIVKIVEDISHLNKMCSLEFSGNLITDVPIEIKNCRKITKVELNYNKIIYFPEG
LCALESLYYLSFSGNYISEIPVDISFSNQLLHLALNQNKLLIFSEHLCSLINLRYLDLGK
NQIKKVPPSVSKMVSLRVLILYSNKFETFPVELCTLENLQVLDFSENQLQTVPSEICNLK
GIQKLNFSSNQFIYFPVELCQLQSLEELNMSQINGRKLTRIPEELSNMTQLKNLDISNNA
IREIPKKMGELRSLVNLYAQNNQISYLPPSFLSLNNLQQLNLSGNNLTALPGAICNLSSL
REINFDDNPLLRPPMEICKGKQLHTIACYLQRADERDGSNIEKILEKTFKIVANNITETN
FVFLCQKMNLPISDTDMPTKSTVSLNERVYQALVKWKMESNNLPLTAAALKDQLVRALTM
IGAYEIMDKITALNLFTRAIKF
Download sequence
Identical sequences G1SM17
ENSOCUP00000003936 9986.ENSOCUP00000003936 ENSOCUP00000003936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]