SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004263 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004263
Domain Number 1 Region: 6-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000051
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004263   Gene: ENSOCUG00000004931   Transcript: ENSOCUT00000004929
Sequence length 136
Comment pep:novel scaffold:oryCun2:GL019185:98375:98833:1 gene:ENSOCUG00000004931 transcript:ENSOCUT00000004929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGHSTVMMAFEDLAVYFTWEEWQNMNMLFLGHCITKPDLIFKLEQGAQPWMVSEFLNQNL
PVAMKSDDIIRTNQEIQENIFKQNVITNNKTSTPKRVMSIKILSLSSSHVSRLINKKRNY
SSMKPEEYNVCHNVFP
Download sequence
Identical sequences G1SMU0
9986.ENSOCUP00000004263 ENSOCUP00000004263 ENSOCUP00000004263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]