SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004336 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004336
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-27
Family SH2 domain 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004336   Gene: ENSOCUG00000005012   Transcript: ENSOCUT00000005008
Sequence length 127
Comment pep:novel chromosome:oryCun2:X:98832565:98854191:1 gene:ENSOCUG00000005012 transcript:ENSOCUT00000005008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYIYTYRVSQTE
TGSWSAETAPGVHKRFFRKIKNLISAFQKPDQGIVIPLQYPVEKSSARSTQGTTGRREDP
DVCLKAP
Download sequence
Identical sequences 9986.ENSOCUP00000004336 ENSOCUP00000004336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]