SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004747 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004747
Domain Number 1 Region: 461-769
Classification Level Classification E-value
Superfamily Folate-binding domain 1.05e-80
Family Aminomethyltransferase folate-binding domain 0.0000614
Further Details:      
 
Domain Number 2 Region: 49-264,369-451
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.53e-55
Family FAD-linked reductases, N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 266-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.92e-19
Family L-aminoacid/polyamine oxidase 0.062
Further Details:      
 
Domain Number 4 Region: 772-864
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000000474
Family Aminomethyltransferase beta-barrel domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004747   Gene: ENSOCUG00000005470   Transcript: ENSOCUT00000005473
Sequence length 884
Comment pep:novel chromosome:oryCun2:5:29274253:29312122:1 gene:ENSOCUG00000005470 transcript:ENSOCUT00000005473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALLADGMFCRWLSIIRRRRASPARRRCSSARGSTSAAEARAAALPAQAQVVICGGGIMG
TSVAYHLSKMGWKDVVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYQQLEQ
ETGIQTGYVRTGSISLAQTQDRLISLKRINSRLNVIGIPSEIISPKKVAELHPLLNVHDL
VGALHVPEDAVLSSADVALALASAASQNGVQIYDRTAVLHVMVKKGQVTGVETDKGQIEC
QYFVNCAGQWAYELGLSNEEPVSIPLHACEHFYLLTRPWETPLQSSTPTVVDPDGRIYIR
NWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEILKL
VNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGRYLAEWMVHGYPSENVWE
LDLKRFGALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWM
EKHGFERPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEI
TSTGDQALEILQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKRSFFMISPTDQ
QVHCWAWLKKHMPSDSSLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCK
EMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLR
IEKFFAFWGQDLNTLTTPLECGRESRVKLEKGMDFIGRHALLQQKQNGVYKRFTMFILDD
HDTDLDLWPWWGEPIYRNGQYVGKTTSSAYSYTLERHVCLGFVQNFSDTGEEQVVTADFI
NRGEYEIDIAGHRFQAKAKLYPFTSLFTHKRRKDDVELSDLHGK
Download sequence
Identical sequences ENSOCUP00000004747 9986.ENSOCUP00000016360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]