SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004793 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000004793
Domain Number - Region: 9-65
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0942
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004793   Gene: ENSOCUG00000005524   Transcript: ENSOCUT00000005524
Sequence length 308
Comment pep:novel chromosome:oryCun2:7:159622221:159627701:-1 gene:ENSOCUG00000005524 transcript:ENSOCUT00000005524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPSAPPPYEDRNPLYPGPPPVGGYGQPSVLPGGYPAYPQPGYGHPAGYPQPMPPIHPM
PMNYGPGHSYEGEERAVSDSFGPGEWDDRKVRHSFIRKVYTIISVQLLITVAIIAIFTFV
EPVGKFVRKNVAVYYVSYAVFIVTYLTLACCQGPRRRFPWNIILLTLFTFAMGFMTGTIS
SMYQTKAVILAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTGIVLYF
KYIYWLHMVYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIFTFV
LQLMGDRN
Download sequence
Identical sequences G1SP41
ENSOCUP00000004793 XP_008257351.1.1745 ENSOCUP00000004793 9986.ENSOCUP00000004793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]