SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005225 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005225
Domain Number 1 Region: 392-617
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.22e-28
Family Calponin-homology domain, CH-domain 0.0003
Further Details:      
 
Domain Number 2 Region: 85-245,384-444
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.05e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 
Domain Number 3 Region: 727-758
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000157
Family LIM domain 0.001
Further Details:      
 
Domain Number 4 Region: 696-726
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000967
Family LIM domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005225   Gene: ENSOCUG00000006048   Transcript: ENSOCUT00000006034
Sequence length 1066
Comment pep:novel chromosome:oryCun2:12:97332014:97398818:-1 gene:ENSOCUG00000006048 transcript:ENSOCUT00000006034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTSSNPAHAHFESFLQAQLCRDVLSSFQGLCEALGLEPGGGLPLYHKIKAQLNYWSA
KSLWAKLDKRAGQPVYQQGRACPNTKCLVVGAGPCGLRAAVELAMLGARVVLVEKRTTFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVA
FTGLQPPPRKGEYTGFLGAPSHLGGPGQWVSNYEFDVLISAAGGKFVPEGFTVREMRGKL
AIGITANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVM
TAKKQCLLRLGVLRQDWPETDRLLGSANVAPEALQRFARAAADFATHGKLGKLEFAKDAR
GQPDVSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAALDA
GWMVKRWAEGAGPLEVLAERESLYQLLSQTSSDNMAPAVTQSGQTLPCPQHPHRLPRSGP
LGVRDLYDVAAKEPVQRKSDKIDTGKPATGAADTQEELLRWCQEQTAGYPGVHVTDLSSS
WADGLALCALVHRLRPDLLEPSELQGVGAVEAAARALKVAEHELGIAPMLPAQAVVAGSD
PLGLIAYLSHFHSAFKNMTPRPGPASQTSPGTPNAVLFLGKLQRTLQRTRAKENGEDAGG
KKPRLTVEAETPKTEEAPVPEPSVPLTPPSPQPEADAGDLCALCGERLYVLERLCADGRF
FHRSCFRCHSCEATLWPGSYAQHPEDKHFYCLQHLPQPDRKEDIMDGDSETLELPAAGEN
STPPGPSAPAAPQEGPRQPTRRLIRLSSSERQRLSSLNLTPDQEVEAPPKPPRSCAALAR
QALEGSFVGWGIPAQSPEVLVAMEKEEESPSSSEEEEEEEEEPIDSDLEQALMTLAKTSG
TMNKYPTWRRTLLRRAKEEEMKRFCKAQAVQRRLNEIEASLRELEAEGVRLELALRSQHS
TPEQQKKLWLEQLLQLVQKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREETL
KTAADRQAEDQVLKKLVDVVNQRDALIRFQEERRLSELASGTGAQG
Download sequence
Identical sequences G1SQ80
ENSOCUP00000005240 ENSOCUP00000005225 9986.ENSOCUP00000005240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]