SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005497 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005497
Domain Number 1 Region: 26-244
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.05e-29
Family FAD-linked reductases, N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005497   Gene: ENSOCUG00000006352   Transcript: ENSOCUT00000006355
Sequence length 679
Comment pep:novel chromosome:oryCun2:4:85297133:85308051:1 gene:ENSOCUG00000006352 transcript:ENSOCUT00000006355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACRMWGSPGLLLTLALHPALAVAPARDYCVLGAGPAGLQMAYFLQRAGRDYTVLERAPGP
GSFFARYPRHRKLISINKRYTGRSNAEFNLRHDWNSLLSHDPRLLFKHYSAAYFPDAGDM
QRYLGDFAGRLGLRVQYNTTVLHVALDKDRRAWNGHYFVLTDHKGRVYRCRVLLVATGLS
VPNRVDFPGSEHLEGYESVSVDPEDFVGQNVLILGRGNAAFETAENILGVTNFIHMLSRS
RVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLTDLAILKDREGKFHVTLKFFVE
EAGTNQSADAVTLPQDDSDNFAMRVAYDRVIRCLGWNFDFSIFNESLRLSSGSEFSRKYP
LIRASYEAKGSRGLFVLGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEQRHHGVAWPAT
QHPITQLTSSVLRRVNEASGLYQMFGVLADVILVQENATAFEYLEEFPTQMLAQLESLTG
RRARHGLFVVHMEYGRNFSGPEKDVFFYDRSVGHTEDAWQSNFLHPVIYYYRHLPTEQEV
RFRPAQWPLPRPTAIHHIVEDFLTDWTAPVGHVLPLRRFLENCLGTDLRSFYAESCFLFA
LTRQKLPPFCRQGYLRKQGLASTESLRRHGVESGLMQDHAAAGQHLRDRGQQPGDRRPVG
HPPAAGTLAQSLNSDKEEL
Download sequence
Identical sequences 9986.ENSOCUP00000005497 ENSOCUP00000005497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]