SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005927 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000005927
Domain Number - Region: 62-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00446
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 3-31
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0128
Family KRAB domain (Kruppel-associated box) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005927   Gene: ENSOCUG00000006857   Transcript: ENSOCUT00000006856
Sequence length 119
Comment pep:novel scaffold:oryCun2:GL018833:481764:483628:-1 gene:ENSOCUG00000006857 transcript:ENSOCUT00000006856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLYENLSSLACSGCQLIKPSLISWLEQEEYSNLFSSLSSEWEMQLKTKGSTLQQNFFR
GQTSNGKHMRTSNRVGELCECSQCGDVCSEHSCLKTQTRTQNTGKRRECDQHGKDFLTL
Download sequence
Identical sequences 9986.ENSOCUP00000005927 ENSOCUP00000005927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]