SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006198 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006198
Domain Number 1 Region: 481-578
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.09e-30
Family CUT domain 0.0000253
Further Details:      
 
Domain Number 2 Region: 368-452
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.68e-28
Family CUT domain 0.0000145
Further Details:      
 
Domain Number 3 Region: 673-737
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000727
Family Homeodomain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000006198
Domain Number - Region: 191-247
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00136
Family SinR domain-like 0.079
Further Details:      
 
Domain Number - Region: 616-671
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006198   Gene: ENSOCUG00000007174   Transcript: ENSOCUT00000007175
Sequence length 797
Comment pep:novel chromosome:oryCun2:14:4366826:4440052:-1 gene:ENSOCUG00000007174 transcript:ENSOCUT00000007175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSMDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLK
HSGHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSL
GYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLED
LPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGR
WYKHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRT
PLPNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMN
KPLEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTA
SQSLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTAT
IATERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDP
SPENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQSPSPT
TLGKGESRGVFLPGLPTPAPWLGAAPQVSQPQPQQQQQQQPAPPPPQPQPQPQAGPRLPP
RQPTVASPAESDEENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPK
YTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYKEEELLKDLEESVQDKNANTLFSVKLE
EELSVEGNTDISADLKD
Download sequence
Identical sequences G1SSH7
9986.ENSOCUP00000006198 ENSOCUP00000006198 ENSOCUP00000006198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]