SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Oryctolagus cuniculus 69_2 > ENSOCUP00000006606

Domain assignment for ENSOCUP00000006606 from Oryctolagus cuniculus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOCUP00000006606
Domain Number 1	Region: 85-123
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000000000188
Family	TNF receptor-like	0.00016
Further Details:

Domain Number 2	Region: 336-421
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.00000000000000277
Family	DEATH domain, DD	0.000073
Further Details:

Domain Number 3	Region: 31-83
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.0000000000418
Family	TNF receptor-like	0.0000785
Further Details:

Domain Number 4	Region: 125-165
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.000000000184
Family	TNF receptor-like	0.00013
Further Details:

Domain Number 5	Region: 166-189
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000214
Family	TNF receptor-like	0.00072
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOCUP00000006606 Gene: ENSOCUG00000007635 Transcript: ENSOCUT00000007637
Sequence length	429
Comment	pep:novel chromosome:oryCun2:19:38085635:38101489:-1 gene:ENSOCUG00000007635 transcript:ENSOCUT00000007637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	AGAAGRAMDGPRLLLLPLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDTVCRCAYGYYQDETTG RCEAYRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC SRWADAECEAIPGRWTTRSPAPEGSDSMAPSTQVPEGPPEQELPASTAADVVTTVMGSSQ PVATRGTADSLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGADSRPVNQTPPPEGEK LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLAPSKREERWRKLLNGFRGGHP AATLAAELGSQPEHIDSFTHEASPARALLASWAAQDSATLDALLAALRRIQRADIVESLC SESTATSPV
Download sequence
Identical sequences	9986.ENSOCUP00000006606 ENSOCUP00000006606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]