SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006931 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006931
Domain Number 1 Region: 24-266,304-381,497-547
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-66
Family FAD-linked reductases, N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.54e-31
Family L-aminoacid/polyamine oxidase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006931   Gene: ENSOCUG00000008024   Transcript: ENSOCUT00000008020
Sequence length 555
Comment pep:novel chromosome:oryCun2:4:10990201:11002235:1 gene:ENSOCUG00000008024 transcript:ENSOCUT00000008020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEHGFTDVTVLEASSRI
GGRVQSVNLGHATFELGATWIHGSHGNPVYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGQRVPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREEVRNRI
RADPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAKGIPAHVIQLGKPVRCIHWDQASARARGPEIEPRAEGDHNHDSGEGGQAGEGP
RGSGPDEDERWPVMVECEDCEVVPADHVIVTVSLGVLKRQYPSFFRPGLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGAECNSLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMERCDDEAVAEVCTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKSAPMQVLFSGEATHRKYYSTTHGALLSGQREA
ARLIEMYRDLFQQGP
Download sequence
Identical sequences G1SUA8
ENSOCUP00000006931 ENSOCUP00000006931 XP_002710976.1.1745 XP_017197247.1.1745 9986.ENSOCUP00000006931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]