SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007091 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007091
Domain Number 1 Region: 202-318
Classification Level Classification E-value
Superfamily DEATH domain 2.98e-39
Family DEATH domain, DD 0.00000707
Further Details:      
 
Domain Number 2 Region: 36-86
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000471
Family TNF receptor-like 0.008
Further Details:      
 
Domain Number 3 Region: 91-135
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000471
Family TNF receptor-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007091   Gene: ENSOCUG00000008202   Transcript: ENSOCUT00000008202
Sequence length 320
Comment pep:known chromosome:oryCun2:18:36906550:36932340:1 gene:ENSOCUG00000008202 transcript:ENSOCUT00000008202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGIWVLLPLILTCIAGSLSTSINDCKIKNETQYSTGYLSGNFCCQLCPPGTKKKADCTS
NEGKPDCEPCQEGEEYTDKSHFSSKCRRCSLCDGEHGLEVETDCTTIQNTKCRCKSNFFC
NALKCEHCDPCTMCEHGIIEECTQTSNTKCKEKGSTTGSKHHFLWLLCILLLIPIVLGLR
RYKKHRDGKHGYDKSTALIPEGVPMNFSDVDISKYIPTIAEEMKINEVKEFVRKNGVNEA
KIDEIKNDNIQDTAEQKVQLLRNWHQLHGKKDAYNTLIKGLRKANLCALAEKIQDIVQKD
ITSDHDNLDIRDEKERQSLA
Download sequence
Identical sequences Q9XS29
ENSOCUP00000023210 9986.ENSOCUP00000023210 XP_008268124.1.1745 ENSOCUP00000007091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]