SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007143 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007143
Domain Number 1 Region: 499-740
Classification Level Classification E-value
Superfamily vWA-like 2.67e-76
Family Trunk domain of Sec23/24 0.00000555
Further Details:      
 
Domain Number 2 Region: 272-417,741-833
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 7.59e-70
Family beta-sandwich domain of Sec23/24 0.0007
Further Details:      
 
Domain Number 3 Region: 942-1090
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 9.68e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.00084
Further Details:      
 
Domain Number 4 Region: 837-938
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.23e-25
Family Helical domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 5 Region: 418-498
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 2.62e-23
Family Zn-finger domain of Sec23/24 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007143   Gene: ENSOCUG00000008254   Transcript: ENSOCUT00000008262
Sequence length 1091
Comment pep:novel chromosome:oryCun2:3:17376436:17465722:1 gene:ENSOCUG00000008254 transcript:ENSOCUT00000008262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPGIPASGAAPTGLQAQNGAASASGSPYANGPVQNALMSSQVSVNQGYNSQLPGSYPH
LMPAKTLNPVSGQSNYGGSQGSGQTFNRPPVASHPVTPSRHSGPVPRMPLPASQNPAATP
MPSGSFLPGANLSPPLNWQYNYPSTGSQTNHCPRTSSQLTVSGNTSLTTNHQYAASGDPS
LQNSFVKSGYAAPLPNPPLPTTFQPGAPYVPPPPTGGPPPVRVPQKSSQGAVPQPSFNSA
VNQEGITSDTNNGATMVHSNYDEIEGGGFLATPQITNKNPKMSRSVGYSYPSLPPGYQNT
TPPNATGIPSSSLNYPSGPQAFTQAPLGANHLTASMSGLSLHPEGLRVVNLLQERNMLPP
TPLRPPVPNLHEDIQKLNCSPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQLPV
VTSSTIVRCRSCRTYINPFVSFLDHRRWKCNLCYRVNDVPEEFMYNPLTRVYGEPHRRPE
VQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNTRT
KIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLKTL
PQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNQRSSAK
EIHLTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYHHQ
HNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPD
AGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEVFLGADVQA
ISGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRASVLSNQQPGLMVPFSLRLFPLF
VLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNISD
RTIPQPPLLQLSVEKLSRDGAFLMDAGSVLMLWIGKNCAQSFLTQVLGVQNYASIPQIMT
DLPELDTPESARIIAFISWLRDQRPFFPVLYVIRDESPMKANFLQNMVEDRTESALSYYE
FLLHIQQQVNK
Download sequence
Identical sequences G1SUT8
ENSOCUP00000007143 9986.ENSOCUP00000007143 ENSOCUP00000007143 XP_002710261.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]