SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007306 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000007306
Domain Number - Region: 19-69
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00314
Family Transglutaminase, two C-terminal domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007306   Gene: ENSOCUG00000008455   Transcript: ENSOCUT00000008455
Sequence length 147
Comment pep:known chromosome:oryCun2:13:36833099:36839479:1 gene:ENSOCUG00000008455 transcript:ENSOCUT00000008455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRDLTLQYNIYNVGSSAALEVELSDDSFPPEDFGIVSGMLSVKWDRIAPASNVSHTVVLR
PLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVM
TLPSIGIPLLLWYSSKRKYDTPKTKKN
Download sequence
Identical sequences G1SV74
ENSOCUP00000007306 9986.ENSOCUP00000007306 ENSOCUP00000007306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]