SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007332 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007332
Domain Number 1 Region: 130-174
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000157
Family Hepsin, N-terminal domain 0.057
Further Details:      
 
Domain Number 2 Region: 96-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007332   Gene: ENSOCUG00000008477   Transcript: ENSOCUT00000008482
Sequence length 174
Comment pep:novel scaffold:oryCun2:GL019577:34:2270:-1 gene:ENSOCUG00000008477 transcript:ENSOCUT00000008482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTNVACSSWAQEAEPEPELRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDAD
AVAAQILSLLPLKFFPVLVVGIIALILALAVGLGIHFDCSGKYRCRSSFRCIELSARCDG
VSDCKQGEDEYRCVRVSGQHAALQVFTASAWRTVCSDDWRARHAEVACAQLGFP
Download sequence
Identical sequences G1SV94
ENSOCUP00000007332 9986.ENSOCUP00000007332 ENSOCUP00000007332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]