SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007662 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007662
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.01e-36
Family Calponin-homology domain, CH-domain 0.0000884
Further Details:      
 
Domain Number 2 Region: 87-241,386-468
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 756-789
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000153
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000007662
Domain Number - Region: 790-818
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000856
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007662   Gene: ENSOCUG00000008883   Transcript: ENSOCUT00000008874
Sequence length 2006
Comment pep:known scaffold:oryCun2:GL018809:243393:292098:-1 gene:ENSOCUG00000008883 transcript:ENSOCUT00000008874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKHETMNQAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHRLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLEKGVILHDYADTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREHNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSKYSIDPVTRYPNINVNFLR
PSQVRHLYDTGEMKDIHLEMENLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFQDSLPASDTLDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGYRGERPTLVSTLTDRRMDIAIGNQN
KVKYMATQLLAKFEENAPPQSTGIKRQGSMKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCEYCATTLRLSAYAYDIEDGKFYCKPHYCYRLSGYAQRKRPAVAPLSAKE
AKGPLQDGPTADTNGRASTTTSLAERTPGSNVNGLEEPSIAKRLRGTPERIELENYRLSV
RQAEELEEVPEETQAEHNLSSVLDKGTEEDVASSSSESEMEEEEEEEEEPGLPPSDLGGV
PWKEAVRIHALLKGKSEEELEASKSFEPGNEEEEDEEEEYEEEEEEEYDEEEEESSEAGN
QRLQQIINPADPLEIQADVHWTHIREKEEEERMVPTSDSSTSRVPLDENDLEEDADSEPA
EIEGEAAEDGDPGDTGAELDDDQHWSDDIPSDAETELRLRRQAEIEAELELRVSENEEEP
SLMKPQERGPSQVSSPIRSPQEQVILFTPVHSPVAEGPQVPPASTATTVQSPCERLFPEP
SLPREKPKTESPTDQPIVLSPIRSQPVALPEARTPTSRAGAQPVSPLVPPTPPSTQLPIC
SQPQPSSEATIPSPTQSPIRFQPVPAKTSTPLPTFPVKSPGDTRDKLGSPLTVDEALKRN
DLVEEFWMKSAEIRRSLGLTPVDRSKGPEPSFPSPAFKPVSLKAYSVEKSPQDEGLHLLK
PPPVPKRLGLPKSDGEQPSLLTPKSPSDRELRSGHEERRDLSSSSGLGLQGSSSNMKTLG
SQSFNTSDSTMLTPPSSPPPPPPPDEEPATLQLQRKPYQHKEAEPKASVIPPPPPATFVR
PPREPAQAPREEVRKSFAESVDEIPFADDVEDTYDDKTEESSLQEKFFTPPSCWTRSEKT
PQHPGTRENGRLPALESGALPQKRGLPLVSPEAKELAEERMRARERSVKSQALRDAMAKQ
LSRMQEMETAVGASRSRKAPSTPSQGKELTSKSPRRPALRGSEEPTLKHEATSEEVLSPP
SDSGGPDGSVTSSEGSSGKSKKRSSLFSPRRNKKEKKSKGEGRPPEKPGPSLLEEAAAKP
KSLWKSVFSGYKKDKKKKSDDKSCSSTPSSGATGASGKHRMSPIVRAELQLRRQLSFSED
SDLSSDDILEKSSQKSKREPRTYTEEELNAKLTRRVQKAARRQAKQEELKRLHRAQIIQR
QLEQVEEKQRQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMI
FARELELEDRQSRLQQELRERMAVEDHLKTEEELAEEKKILNEMLDVVEQRDSLVALLEE
QRLREKEEDKDLEAAMLSKGFSLNWS
Download sequence
Identical sequences XP_002722588.1.1745 9986.ENSOCUP00000021852 ENSOCUP00000007662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]