SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007735 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007735
Domain Number 1 Region: 154-540
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.51e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000044
Further Details:      
 
Domain Number 2 Region: 515-642
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.75e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000943
Further Details:      
 
Domain Number 3 Region: 62-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-26
Family Thioltransferase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007735   Gene: ENSOCUG00000008949   Transcript: ENSOCUT00000008955
Sequence length 645
Comment pep:novel chromosome:oryCun2:9:5914256:5968097:-1 gene:ENSOCUG00000008949 transcript:ENSOCUT00000008955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPPPPRALASPGPGRVGVSPNRRLDSVRGMPTSSPPGRRARVLSPGTSRPSSEAREELR
RRLLELIEGNRVMIFSKSYCPHSARVKELFSSLGVDYNILELDQVDDGANVQEMLSEITN
QKTVPNIFVNKVHMGGCDRTFQAHQSGLLQKILQEESAYEYDLIVIGGGSGGLSCAKEAA
ILGRKVMVLDFVVPSPRGTSWGLGGTCVNVGCIPKKLMHQAALLGQALRDSRKFGWEYSQ
QVKHNWETMTEAIQNHIGSLNWGYRLSLRERGVTYVNSYGEFVEHHTVKATNRKGQETYY
TSANFVIATGERPRYLGIPGDKEFCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGL
GLDVTVMVRSILLRGFDQEVAEKVGSYMQQHGVKFLRKFVPVMVQQLEKGSPGKLKVTAK
STEGPETIEGVYNTVLLAIGRDSCTRNIGLEKIGVRINEKNGKIPVNDVEQTNVPYVYAV
GDVLEGKPELTPVAIQAGKLLARRLHGASSEKCDYFSIPTTVFTPLEYGCCGLSEEKATE
LYMKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNKLDQDRVIGFHVLGPNAGEITQGF
AAAMKCGLTKQLLDETIGIHPTCGEVFTTLEITKSSGLAVTQQGC
Download sequence
Identical sequences G1SW84
9986.ENSOCUP00000007735 ENSOCUP00000007735 ENSOCUP00000007735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]