SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008416 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008416
Domain Number 1 Region: 54-184,215-332
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.46e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.064
Further Details:      
 
Domain Number 2 Region: 622-696
Classification Level Classification E-value
Superfamily EF-hand 2.68e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 313-407
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000112
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008416   Gene: ENSOCUG00000009764   Transcript: ENSOCUT00000009769
Sequence length 730
Comment pep:known chromosome:oryCun2:7:95334550:95456666:1 gene:ENSOCUG00000009764 transcript:ENSOCUT00000009769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAFKGTVLVGGGALATVLGLSQFAQYRRKQVNLAYVEAAECFTEPVNREPPSREAQ
LLTLQNTPEFDILVIGGGATGSGCALDAVTRGYTGLKTALVERDDFSSGTSSRSTKLIHG
GVRYLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGI
KLYDLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAA
RYGAATANYMEVVSLLKKTDPETGKDCVRGARCKDVLTGQEFDVRAKCVINATGPFTDSV
RKMDDKNAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDT
PTDITSHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPNSADTQSIS
RNHVVDISESGLITIAGGKWTTYRSMAEDTVNAAIKTHNLKAGPSRTVGLFLQGGKDWSP
TLYIRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPVVGVRLVSEFPYIEAEV
KYGVKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDRKKEQELETARK
FLYYEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINV
QMDENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVP
IPVDRSCGGL
Download sequence
Identical sequences 9986.ENSOCUP00000008416 ENSOCUP00000008416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]