SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008550 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008550
Domain Number 1 Region: 61-92,205-245,287-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000561
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008550   Gene: ENSOCUG00000009931   Transcript: ENSOCUT00000009928
Sequence length 549
Comment pep:novel chromosome:oryCun2:3:105346601:105370361:1 gene:ENSOCUG00000009931 transcript:ENSOCUT00000009928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLSGHFRNYSDSETEGEIFNSLVQYFGDNLGQKVKAMPLVEETSLLGDSSVT
LPVVIIGNGPSGICLSYMLSGYRPYLSSEAMHPNAILHSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNFKH
LKVLIALLSELALFGLLFSSHLASSKQNLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSVSRLYREQDDNDSQDGDVSTKHLQIEKSKFIKRNWEIRGYQRIADGSHVPFCLFAE
NVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADA
VLCAYNNNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHLMCTQSYSVDSNLLSDYT
SFPEHHVLSFKSDMKCILQSISGLKKIFKLSAAVVLIGSHPNLSFLKEQGCYLGHNSSQP
ITCKGNPVEIDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFV
ERGGGDGIS
Download sequence
Identical sequences G1SY71
ENSOCUP00000008550 9986.ENSOCUP00000008550 ENSOCUP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]