SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008624 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008624
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-16
Family Caspase recruitment domain, CARD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008624   Gene: ENSOCUG00000010013   Transcript: ENSOCUT00000010012
Sequence length 224
Comment pep:novel chromosome:oryCun2:5:22786884:22789837:1 gene:ENSOCUG00000010013 transcript:ENSOCUT00000010012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLNGPEYEALDALPDAERRVRR
LLLLVQSKGEAACQELLRCAQQTARAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGS
GTLCPGLPGASDHDEAGGPEGSEAVQSGTPEEPELEAEGAEQDLEPEPEPEPELEVDPTS
PLPQPSFSSPEHHPLPYPTPNPWVPMYASPPSSPSPRSDSREGA
Download sequence
Identical sequences G1SYD5
ENSOCUP00000008624 9986.ENSOCUP00000008624 ENSOCUP00000008624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]