SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Oryctolagus cuniculus 69_2 > ENSOCUP00000008744

Domain assignment for ENSOCUP00000008744 from Oryctolagus cuniculus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOCUP00000008744
Domain Number 1	Region: 363-452
Classification Level	Classification	E-value
Superfamily	DEATH domain	3.24e-24
Family	DEATH domain, DD	0.0000234
Further Details:

Domain Number 2	Region: 100-142
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.0000000000000542
Family	TNF receptor-like	0.00017
Further Details:

Domain Number 3	Region: 144-196
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.000000000385
Family	TNF receptor-like	0.00025
Further Details:

Domain Number 4	Region: 42-99
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.000000000895
Family	TNF receptor-like	0.0000352
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOCUP00000008744 Gene: ENSOCUG00000010146 Transcript: ENSOCUT00000010146
Sequence length	461
Comment	pep:novel chromosome:oryCun2:8:32401204:32415579:-1 gene:ENSOCUG00000010146 transcript:ENSOCUT00000010146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGLPTVPGLLLPLVLLALLEIHPLGVAGLVPHLGDWEKGETVCPQGKYNHSQNKSICCTK CHKGTYLYNDCPGPGLDSDCRKCENGTFTASENHLTQCLSCSKCRKERNQVEISSCTVDH DTVCGCRKNQYRRYWAKTQFQCSNCSLCLNGTVIIPCQESQDTVCDCHAGFFLRENQCVP CSNCKENPVCMKLCLPPTGNVQGSQDSGATVLLPLVIFFGLCLLSLLFTVLMCHYQRRWK PKFYSIVCGKATPVKEGELEGLPAKPLAPAPGVCPPPGFSPIPGFSPDLGICTNSTSTFP REDWPSFRAMPPSRGVALAYREAEPVHTTALASTPILTPLQKWEDCSAPAAVAPQQRPDT DPVTLYAVVDGVPPSRWREFVRRLGLREHEIERLELQNGRCLREAQYSMLAAWRQRTPRH EATLDLLGSVLRDMDLLGCLEDIEAVLGGPASQPSEARLPR
Download sequence
Identical sequences	G1SYP2 ENSOCUP00000008744 ENSOCUP00000008744 XP_002712881.1.1745 9986.ENSOCUP00000008744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]