SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008745 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008745
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000288
Family KRAB domain (Kruppel-associated box) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008745   Gene: ENSOCUG00000010148   Transcript: ENSOCUT00000010147
Sequence length 152
Comment pep:novel scaffold:oryCun2:GL018902:27038:29711:-1 gene:ENSOCUG00000010148 transcript:ENSOCUT00000010147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVMITFEDLAVYFTWEEWQHMNIREFVSMNNPKVVSSSLTLFALIGHCITKPDLIFKLE
QGAEPWMVNEFLNQNLPVAMKSDDIIRTNQEIQEKNFKQNVITNNKTSTPRRVELNKRLN
LNSSHVSKLINKKRNYSSMKPEEYNVCHNVYP
Download sequence
Identical sequences G1SYP3
9986.ENSOCUP00000008745 ENSOCUP00000008745 ENSOCUP00000008745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]