SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008887 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008887
Domain Number 1 Region: 7-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.5e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000097
Further Details:      
 
Domain Number 2 Region: 365-493
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.47e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008887   Gene: ENSOCUG00000010314   Transcript: ENSOCUT00000010315
Sequence length 495
Comment pep:novel scaffold:oryCun2:GL018826:764040:801540:1 gene:ENSOCUG00000010314 transcript:ENSOCUT00000010315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHPPSPAGQPTYDLLVIGGGSGGLACAKEAAQLGRKVAVLDYVEPSPPGTRWGLGGTCV
NVGCIPKKLMHQAALLGGAIRDAGRYGWEVAQPARHDWSKMAEAIQNHVRSLNWGHRVQL
QERKVKYLNVKARFIDKHTVLGVSKDKKETLLSADHIVIATGGRPRYPTLIQGASEYGIT
SDDIFWLKESPGKTLVVGASYVALECAGFLTGLGLDTTIMIRSIPLRGFDQQMASLVTDH
MASHGTRILRGCTPSRVARLPDGRLQVTWEDRTCGKEDSGVFNTVLWAIGRVPETRGLNL
EGAGVETNPESQKILVDARDTTSVPHIYAIGDVAEGRPELTPTAIMAGKLLAQRLFGGSS
DLMDYSNVPTTVFTPLEYGCVGLSEEEAVARHGQEQIEVYHAYYKPLEFTVAEQDASQCY
IKMVCLRQPPQPVLGLHFLGPNAGEVTQGFALGIKCGASYEQVIRTVGIHPTCAEEMVKL
RISKRSGLDPTVTGC
Download sequence
Identical sequences ENSOCUP00000008887 9986.ENSOCUP00000008887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]