SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009042 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009042
Domain Number 1 Region: 27-56,172-308,404-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000149
Family FAD/NAD-linked reductases, N-terminal and central domains 0.087
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000009042
Domain Number - Region: 300-465
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.011
Family FAD/NAD-linked reductases, N-terminal and central domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009042   Gene: ENSOCUG00000010496   Transcript: ENSOCUT00000010493
Sequence length 489
Comment pep:novel chromosome:oryCun2:5:37978370:37983709:1 gene:ENSOCUG00000010496 transcript:ENSOCUT00000010493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRLPASSLPPAPAMSSSRKDRLSSPEPLPVVIIGNGPSGICLSYLLSGYTPYVRPDAVHP
HPLLQRKLAEAPGVSILDQDLDYLSEGLEGRRAPVALLFGRPSCAPDTDFGGGTWSPVLT
WKAGKSTEAVPPRGPWAATPPGGALEREKGAPPALPLGSSSPLPDTCSPWFLRRGLRNSR
ATAGDMAHYYRDYVSRKGLSHNFVSGAVVTAVEWGPPAPGGSGAQDGSPLFRVSGFLTAK
DRRRQPFSLRARNVVLATGTSDSPARLGVPGEALPFVHHDLAALEAAVRVGAVGPDSDPV
LIIGAGLSAADAVLLARHYSVPVLHAFRRPVDDPALVFNQLPKMLYPEYHKVHQMMREQA
GPSPSPYAGYRSLPEHRVLLFKAQRQAVLRDPRGGQAVLGVSLVLVLIGSHPDLSFLPGA
GAALAVEPAQPLSARRNPVDVDPFTYQSARQEGLYAVGPLAGDNFVRFVQGGALAAASSL
QKKEAGRPP
Download sequence
Identical sequences G1SZE5
ENSOCUP00000009042 ENSOCUP00000009042 9986.ENSOCUP00000009042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]