SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009645 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009645
Domain Number 1 Region: 40-339
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.81e-24
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009645   Gene: ENSOCUG00000011208   Transcript: ENSOCUT00000011209
Sequence length 509
Comment pep:novel chromosome:oryCun2:2:115940461:115957889:-1 gene:ENSOCUG00000011208 transcript:ENSOCUT00000011209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSEAMGRVAGERFPSLLGLWLLLCSWGCPGNAELRAPPDKIAIIGGGIGGTSAAYYLRQK
FGKDVKIDVFERGEVGGRLATLNVQDQEYEAGGSVIHPLNLHMKRFVKDLGLSTVQVSSG
LVGVYDGEALVFEESSWFIINMIKLIWRYGFQSLRMHMWVEDLLDKFMRIYRYQSHDYAF
SSVEKLLHALGGDDFVGSLNRTLLETLQKAGFSEKFLHELVAPVMRTNYGQNLDINTFVG
AVSMACTDSGLWAVEGGNKLVCSGLLRASKSNLISGSVMSIEEKTRTKQTGNPTKMYEVV
YQTGSETHSDFYDIILVATPLNRNMANITFLNFDPPIEEFHQYYQPIVTTLVKGELNSTF
FSSRAKDKFGLSTVLTMDNLDLFINSVGITSSVRNKDDPQPSTDGTHVWKIFSRETLTKA
QILKLFLSYDYAVKKSWLACPQYKPPEKCPSIILHDRLYYLNGIEWAASAMEMSAIAAHN
AALLAYHRWNGRTDMIDQDGLYEKLKTEL
Download sequence
Identical sequences 9986.ENSOCUP00000009645 ENSOCUP00000009645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]