SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009823 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009823
Domain Number 1 Region: 49-276,308-336
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-40
Family FAD-linked reductases, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009823   Gene: ENSOCUG00000011422   Transcript: ENSOCUT00000011421
Sequence length 463
Comment pep:novel chromosome:oryCun2:17:69328315:69383114:-1 gene:ENSOCUG00000011422 transcript:ENSOCUT00000011421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAALRYLGGACRGARGALRGGFPRACGPAWRRPWSLCRGDRSASTSSFDVVIVGGGIVG
LASARALILRHPALSIGVVEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALM
YEYCNQKGISYKQCGKLIVAVEQEEIPRLQALYERGLQNGVQGLRLIQQEDIKKKEPYCR
GLMAVDCPYTGIVDYRQVALSFAQDFQQAGGSILTNFEVNDIEMAKESPSRSKDGMKYPI
VIKNTKGEEVRSQYVVTCAGLYSDRISELSGCNPDPRIVPFRGDYLLLKPEKCYLVKGNI
YPVPDSRFPFLGVHFTPRMDGSIWLGPNAILAFKREGYRPFDFNARDVMDIIINSGLFKL
VFQNFSYGVSEMYKACFLGETVKHLQKFIPEITIGDILRGPAGVRAQALDRDGNLVEDFV
FDGGVGDIGSRILHVRNAPSPAATSSLAISEMIADEVQQRFEL
Download sequence
Identical sequences G1T197
XP_002718278.1.1745 ENSOCUP00000009823 9986.ENSOCUP00000009823 ENSOCUP00000009823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]