SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010138 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010138
Domain Number 1 Region: 6-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-66
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 577-667
Classification Level Classification E-value
Superfamily DEATH domain 1.74e-24
Family DEATH domain, DD 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010138   Gene: ENSOCUG00000011791   Transcript: ENSOCUT00000011792
Sequence length 670
Comment pep:novel scaffold:oryCun2:GL018715:2549274:2583836:-1 gene:ENSOCUG00000011791 transcript:ENSOCUT00000011792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQADMSLDDIKMKSSDFLEKADLDSGGFGEVSLCFHRLHGLVILKKVYTGPKRAEYNESL
LEEGRMMHRLKHSRVVELLGVVMEEGNYCLVMEYMEKGSLMHVLKAEISIPLSVKGRIIA
ETIEGMCYLHGEGVIHKDLKPENILVDNDFHIKIADLGVASFKTWSKLTKEEHNEQRKVN
STRKKTGGTLCYMAPEHLNDVNAKPTEKSDVYSFAIVLWAVLANKEPYENAICEQQLILC
IKSGNRPDVDDVAEDCPGELIRLMELCWEADPRARPTFPDIEERFRPFYSSHYEEFVEED
VKSLKKRYPEQSAVVKRMQSLQLDCVPVPPSRSNSATEQPSSLHSSQGFMTGPVEVSFFS
ACPEISQEENEPSLQSKLQEEANYHLYGSRMDKQTRQPPRQSVAYSREEERRRRVSYDPF
AQQTPYENVQKTGIKVHSYPGTTSHSNAAHQPTGLTSQPQLPYWNNGVYSLHGFGTRPLE
PGTAGQAVWYGPSLSPMSSLYKTPVPETNLLGNTPTIPFSSLSPAEESMKCSIYNSSGIQ
LGACNYMEIGGISSPPLECLCTNLQEPASKYQAIFDDTTSLTDKHLSPVRDNLGKHWKNC
ARKLGLTESQIDEIDHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLARALHQCSRQDL
LTCLIQLSQK
Download sequence
Identical sequences G1T201
9986.ENSOCUP00000010138 ENSOCUP00000010138 ENSOCUP00000010138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]