SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011031 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011031
Domain Number 1 Region: 4-443,555-610
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-78
Family GDI-like N domain 0.000000000000497
Further Details:      
 
Domain Number 2 Region: 443-554
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.26e-40
Family GDI-like 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011031   Gene: ENSOCUG00000012819   Transcript: ENSOCUT00000012819
Sequence length 648
Comment pep:novel chromosome:oryCun2:X:76683786:76889861:-1 gene:ENSOCUG00000012819 transcript:ENSOCUT00000012819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLPSEFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRNYYGGNWASFSFSGLLSWIK
EYQENGDTTNESSRWQEQVLENEEAIGLSKKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHASVTSANSTEAADSACLPTEDESLSIVSCEMSAEQTPSSDPESAPEVNDAEATGEKGD
HCDDKTSEEETSTNVPTAADTIEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDL
LIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLSMVEKRMLMKFLTFCMEY
EEHPDEYKGYEEIAFSEYLKTQKLTPNLQYFVLHSIAMTSETTTTTLDGLKATKNFLHCL
GRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAIIDQFGQ
RIMSTHFLVEDSYLSENMCSHVQYRQISRAVLITDRSVLKTDSDQQISILTVPAEEPGTS
AVRVIELCSSTMTCMKGTYLVHLTCTSSKTARDDLEPVVQKLFTPFTEMEIEKEEVEKPR
ILWALYFNMRDSSDIDRNCYKDLPSNVYVCSGPDCALGNDNAVKQAETLFQQIYPNEDFC
PPPPNPEDIILDGDSSQPGASESIAIPEANSETPEESANLENPQAPSE
Download sequence
Identical sequences G1T452
9986.ENSOCUP00000011031 ENSOCUP00000011031 XP_008271215.1.1745 ENSOCUP00000011031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]