SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011427 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011427
Domain Number 1 Region: 291-536
Classification Level Classification E-value
Superfamily vWA-like 1.78e-58
Family Trunk domain of Sec23/24 0.00047
Further Details:      
 
Domain Number 2 Region: 538-633
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.1e-37
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 3 Region: 26-308
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.12e-36
Family beta-sandwich domain of Sec23/24 0.0042
Further Details:      
 
Domain Number 4 Region: 740-881
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.57e-30
Family C-terminal, gelsolin-like domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 5 Region: 634-739
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.62e-29
Family Helical domain of Sec23/24 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011427   Gene: ENSOCUG00000013272   Transcript: ENSOCUT00000013279
Sequence length 885
Comment pep:novel chromosome:oryCun2:15:94031025:94146142:-1 gene:ENSOCUG00000013272 transcript:ENSOCUT00000013279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMAPSSQGPPGPPSAAAFQGPPRPPQPSILQPGSQVLPPPPTTLNGPGASSAPPTAQYQ
PPPLPGQTLGPGFPPQQAANYGPQMAGAQLSYPGGFPGGPAQMAGPPQPQKKLDPDSIPS
PIQVIENDRAIRGGQVYATNTRGQVPPLVTTDCVIQDQGNASPRYIRCTTYCFPCTSDMA
KQAQIPLAAVIKPFATVPPNETPLYLVNHGETGPVRCNRCKAYMCPFMQFIEGGRRYQCG
FCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRKNKPPNPPAFIFMI
DVSYSNIKNGLVKLICEELKTVLEKLPKEEHEETSAIRVGFITYNKVLHFFNVKSNLAQP
QMMVVTDVGEVFVPLLDGFLVNYQESQAVIHNLLDQIPEMFADSNENETVFAPVIQAGME
ALKGQHCSHSTGLHTGLESCSSAAKRKNQQQQKRIIFKKEEILFQPQTNVYDSLAKDCVA
HGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYKYNNFQMHLDSQQFLNDLRNDIEKKIGF
DAIMRVRTSTGFRATDFFGGIFMNNTTDVEMAAIDCDKAVTVEFKHDDKLGEDSGALIQC
AVLYTTISGQRRLRIHNLGLNCSSQLADLYKSCETDALINFFAKSAFKAVLHQPLKVIRE
ILVNQTAHMLACYRKNCASPSAASQLILPDSMKVFPVYMNCLLKNCVLLSRPEISTDERA
YQRQLVMTMGVADSQLFFYPQLLPITERDVKSTELPAAVRCSESRLSEEGIFLLANGLNM
FLWLGVSSPPELIQGIFNVPSFAHINADTTLLPEVGSPYSQQLKMIMNIIQQKKPYSMKL
MIVKQREQPEMVFRQFLVEDKGLYGGPSYVDFLCCVHKEICQLLN
Download sequence
Identical sequences 9986.ENSOCUP00000011427 ENSOCUP00000011427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]