SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012005 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012005
Domain Number 1 Region: 470-759
Classification Level Classification E-value
Superfamily Folate-binding domain 2.83e-84
Family Aminomethyltransferase folate-binding domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 43-257,368-430
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.97e-59
Family FAD-linked reductases, N-terminal domain 0.00038
Further Details:      
 
Domain Number 3 Region: 257-367
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.32e-28
Family L-aminoacid/polyamine oxidase 0.0082
Further Details:      
 
Domain Number 4 Region: 761-847
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 7.85e-22
Family Aminomethyltransferase beta-barrel domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012005   Gene: ENSOCUG00000013960   Transcript: ENSOCUT00000013965
Sequence length 856
Comment pep:novel scaffold:oryCun2:GL019088:64562:120127:1 gene:ENSOCUG00000013960 transcript:ENSOCUT00000013965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVHLAVSRGAGARGRGESGVPPGCRQQRGREEKPDTTWKDRAEIVIIGGGCVGVSLAYHL
AKAGMRDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLEEETGQAVG
FHQPGSIRLATTPVRVDEFKYQMTRAGWHATEQYLIGPEKVQEMFPLLNVDKVLAGLYNP
GDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLAPRSDGTWDVDTPQGSVRAKRLVNAA
GFWAREVGKMIGLEHPLIPVQHQYLVTSTIPEVKALKRELAVLRDLEGSYYVRQERDGLL
LGPYERQEKMRVQDSWVTDGVPPGFGKELFEADLDRITEHLEIAMEMIPVLKKADIVNVV
NGPITYTPDILPMVGPHQGVRNYWVAVGFGYGIIHAGGIGKYLSEWILQGEPPFDLIELD
PNRYGRWTTPQYTEAKARESYGFNNVVGYPKEERFAGRPTQRVSGLYSILQPRCSMGFHA
GWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYEQVMQKVGVIDLSPFGKFHIKGRDSV
TLLDNLFANVVPKVGFTNISHMLTPRGRVYAELTVSHQAPGDFLLVTGSGSELHDLRWIE
EAAIRGGYEVEISNTTDELGVLGVAGPRARQVLQKLTSEDLSDGAFKFLQVKPLKVAHVP
VTAIRISYTGELGWELYHRREDSPALYEALMNAGQEEGIADFGTYALNVLRLEKAFRAWG
AEMNCDTNPLEAGLEPFVKLDKPADFIGKHALRQIKASGLKRRLVCLTLATDDVDPEGNE
SVWYEGKVVGNTTSGAYSYSIHKSLAFAYVPVALGAVGQQVEVELLGRNYPAVVTREPLV
LPEPVRSRLQKKGEKR
Download sequence
Identical sequences ENSOCUP00000012005 9986.ENSOCUP00000012005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]