SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012031 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012031
Domain Number 1 Region: 51-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-18
Family HkH motif-containing C2H2 finger 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012031   Gene: ENSOCUG00000013999   Transcript: ENSOCUT00000013995
Sequence length 133
Comment pep:novel chromosome:oryCun2:13:139147064:139147760:-1 gene:ENSOCUG00000013999 transcript:ENSOCUT00000013995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGPPRPPLHPDAEPPDLPGGGLH
RCLACARYFIDSANLKTHFRSKDHKKRLKQLTVEPYSQEEAERAAGMGSYVPPKRLAVPA
EVSTETPEMDTSS
Download sequence
Identical sequences G1T6I5
ENSOCUP00000012031 9986.ENSOCUP00000012031 ENSOCUP00000012031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]