SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012334 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012334
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.33e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012334   Gene: ENSOCUG00000014347   Transcript: ENSOCUT00000014347
Sequence length 450
Comment pep:novel chromosome:oryCun2:17:26919512:26948824:-1 gene:ENSOCUG00000014347 transcript:ENSOCUT00000014347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLVTVMSGPHARLFACLLRLGPQQVGSLQLHTGASCAARSHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKAKVAE
LNPDKNCIQTDNGKEISYKYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGTIFGVK
KYAEALEEIIQERNLTVNYKQNLIEVRADKQEAVFENLDKPGETQVFSYEMLHVTPPMSP
PDVLKTSPVADAAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPMKKYDGYTSCPLVTGYNSVILAEFDYTARPLETFPFDQSKERLSMYLMKAD
MMPFLYWNLMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences G1T782
XP_002717932.1.1745 ENSOCUP00000012334 ENSOCUP00000012334 9986.ENSOCUP00000012334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]