SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012372 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012372
Domain Number 1 Region: 389-444,475-527
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 5.23e-31
Family Supernatant protein factor (SPF), C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 83-170
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 1.22e-18
Family Acyl-CoA binding protein 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000012372
Domain Number - Region: 244-312
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012372   Gene: ENSOCUG00000014391   Transcript: ENSOCUT00000014388
Sequence length 528
Comment pep:novel chromosome:oryCun2:16:48163912:48211198:-1 gene:ENSOCUG00000014391 transcript:ENSOCUT00000014388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGAGRVPGAAGEPLEP
GEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL
MGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVGFVKLLNRCCHLFSTYVASHK
IEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRQEEEERRRVEEERLRLE
QQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQ
QAALQKQQEVVVAGASLPTSSKVNATVSSDMMSVNGQAKTHTDNSEKELEPETAEEALEN
GPKESLPVIAAPSMWTRPQIKDFKEKIRQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENVTSEEKAKKNATKPLLDEIV
PVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKAVYYRVYYTR
Download sequence
Identical sequences G1T7B1
9986.ENSOCUP00000012372 ENSOCUP00000012372 ENSOCUP00000012372 XP_002717528.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]