SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012612 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012612
Domain Number 1 Region: 39-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.73e-59
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000517
Further Details:      
 
Domain Number 2 Region: 384-500
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.7e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012612   Gene: ENSOCUG00000014667   Transcript: ENSOCUT00000014667
Sequence length 508
Comment pep:novel chromosome:oryCun2:7:44419812:44453398:1 gene:ENSOCUG00000014667 transcript:ENSOCUT00000014667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYCSLAKRGHFNRISHGIQGVSVVPLRTYADQSIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
EKMMEQKSTAVKALTGGIAHLFKQNKVFHRYNFKLLTSTNQVTATKADGSTQVIDTNILV
ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTA
VEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKPDGKIDVSIEAASGGKA
EVITCDVLLVCIGRRPFTQNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPM
LAHKAEDEGILCVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKF
PFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIA
RVCHAHPTLSEAFREANLAASFGKSINF
Download sequence
Identical sequences G1T7V5
9986.ENSOCUP00000012612 ENSOCUP00000012612 ENSOCUP00000012612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]