SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012963 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012963
Domain Number 1 Region: 128-394
Classification Level Classification E-value
Superfamily vWA-like 1.18e-88
Family Trunk domain of Sec23/24 0.000000817
Further Details:      
 
Domain Number 2 Region: 8-66,411-519
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.92e-63
Family beta-sandwich domain of Sec23/24 0.00041
Further Details:      
 
Domain Number 3 Region: 623-763
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.36e-55
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000612
Further Details:      
 
Domain Number 4 Region: 520-622
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.66e-46
Family Helical domain of Sec23/24 0.00000779
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.83e-21
Family Zn-finger domain of Sec23/24 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012963   Gene: ENSOCUG00000015079   Transcript: ENSOCUT00000015084
Sequence length 767
Comment pep:known chromosome:oryCun2:4:17852463:17890196:-1 gene:ENSOCUG00000015079 transcript:ENSOCUT00000015084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYTGISEVNQPAELMPQFSTIEYV
VQRGPQTPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKSAMPMQQPRPAQAQEHSFISSRFLQPIHKIDM
TLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKVPIRSWHDIEKDNARFMKKATKHYEILANRTAANGHCIDIYACALDQTGLL
EMKCCTNLTGGHMVMGDSFNTSLFKQTFQRIFSKDFNGDFRMAFGATLEVKTSRELKIAG
VIGPCVSLNVKGPCVSENELGVAGTSQWKICGLDPTTTLGIYFEVVNQHNAPIPQGGRGA
IQFVTQYQHSSTQRRIRVTTIARNWADAQSQLRHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPSSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFQGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLFAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
Download sequence
Identical sequences G1T8P7
ENSOCUP00000012963 XP_002710997.1.1745 XP_008254567.1.1745 9986.ENSOCUP00000012963 ENSOCUP00000012963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]