SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013240 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013240
Domain Number 1 Region: 24-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-21
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 2 Region: 177-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000629
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013240   Gene: ENSOCUG00000015416   Transcript: ENSOCUT00000015410
Sequence length 272
Comment pep:novel scaffold:oryCun2:GL018752:1664612:1666367:1 gene:ENSOCUG00000015416 transcript:ENSOCUT00000015410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPPAPLLTLRPGETRPCCGKPGAVRFADVAVYFSSEEWGCLRPAQRALYRDVMRENYG
HLGALGFPGPKPALISWMERESEAWSPAAQDPDEGQSPGGALRGQVPNKKEEEEEPQEAA
GVKGPANAPEDLVTHSPDPPISKASARAEPPPAKVAWDRTAGAQPPAPGADSQASQRRHV
CADCGRRFTYPSLLVSHRRMHSGERPFPCPECGTRFKRKFAVEAHQWIHRSCSGGRRGRR
PGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG
Download sequence
Identical sequences G1T9D5
XP_002721784.1.1745 ENSOCUP00000013240 ENSOCUP00000013240 9986.ENSOCUP00000013240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]