SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013324 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013324
Domain Number 1 Region: 666-781,946-999
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000317
Family FAD/NAD-linked reductases, N-terminal and central domains 0.065
Further Details:      
 
Domain Number 2 Region: 464-570
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000562
Family N-acetyl transferase, NAT 0.033
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000013324
Domain Number - Region: 183-249
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000221
Family N-acetyl transferase, NAT 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013324   Gene: ENSOCUG00000015506   Transcript: ENSOCUT00000015509
Sequence length 1238
Comment pep:novel chromosome:oryCun2:4:16246538:16494786:-1 gene:ENSOCUG00000015506 transcript:ENSOCUT00000015509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLTSPRGKVEVVHCRRTESQDIHCIKSLIRKFTQKLFGKFNIIYLLEKANLAITLHND
KEEIMAQATFLDYPNWNVAKQDDWVSVFRELDSEIPCTPLNTLFMHLFVAVDEYSVDCCK
EIIRTVFKAVPELHFIFLIVPYYMSLVGSTLSTVFDQVGNVPCLTYKEDFAVHICHRHNH
YPQLHIRKARVEDHDNLMPIFLRHDTILKETYGEYFLAELIEAQDEENHAVVCEVEGEAV
GFMSVCSRVNMLLLHECFDLRPFHGLCMPHPDDILDLPQEPMMRKSQKDAELSSNSQDSQ
NIVEEPQEPFSPEPKESIQGKVEEATSGERLPAIHGGNSSEMEDLENVSQFSTMDEQTQY
MVSRSSASSLLHEEPSYFRPIYRGAPAAFCIQLFCIDEKHAARSLDFMNFVFSLFPDKNF
CIISLPHLTPEFNLIQNFVKIVPFDNCTLQQDLYVFSRAGLLKSIDIRLATLRDTPGVEN
LVSTLLLSKSLLEDLDQYNEARRDPDGTPLQVFVAEVAEEIVGIAVIRNEMDIEYIRSHY
NIEDFIYFSHHQREEHGHLYHFALNPVFRHYTKFFLKEILRLGYKSCLYYPIYPQCREGK
FQRPYAHSLTSALHYFVPVRPRRQIVYPLEKLGTNAPSKAVSKEPLSYALNHTNRKLTLE
PKITVNARIVVVGASNVGISFLETLVFCSHLKFNSLTLISTHGLPGKKLLGHEQRKFLAS
DYCFNDKDYALMSLCSWVNVVVGRMTAIDRVAKHVVVSHEDIVYYDHLILCTGQQYQVPC
PTGADISQHLTNREVPNFSKLRYTGKVPCNLFTLNDEEDCFKALAWIRNNSITAEGNVIV
YGNTIDTYTTVETLLHLGVKGSCIHLVQPPTASTITCLNNYSVESAVDGALRAAGVTVHQ
EAILAQWNEGRYPDPICSASFTTQTKPFRLPCSMFFSFCEKNVDYETFKALNDACLVYDG
RLVIDTNFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLNLFDPTLE
PVTEPPADLDRLIPMYKGAKIKGGILPGSYHYLHVSKPGIPTSLEVQMAKSDFGLEIVTG
MVENGTYFRIHINKYRMVESLTCLSKEPFPASNYIRLFGQHEQVLNNLCVRYENEKITDL
YSYFTEPWCLALFHDRFIDLRKELRLILASQKEEQLPSLVELARQIEDEEIELSEKPKKY
LQRVFEDTIYKPLVERSILDYLHYNHYHLPMYAWPGIV
Download sequence
Identical sequences 9986.ENSOCUP00000013324 ENSOCUP00000013324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]