SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013793 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013793
Domain Number 1 Region: 142-412
Classification Level Classification E-value
Superfamily Caspase-like 8.07e-87
Family Caspase catalytic domain 0.000000000765
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily DEATH domain 1.37e-23
Family Caspase recruitment domain, CARD 0.0000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013793   Gene: ENSOCUG00000016047   Transcript: ENSOCUT00000016046
Sequence length 413
Comment pep:known scaffold:oryCun2:GL018791:791183:812098:1 gene:ENSOCUG00000016047 transcript:ENSOCUT00000016046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRQLLRRRLRLVKELQVAELWDALVSCELFTADMIEAIQHAGTRRDQARQLVIDLE
TRGRQALPLFISCLEDTGQHTLASFLRAKKPTAVTSQAALGNLSPVVLGPEELWPAKLRP
EVLRPVDSSSGGFRDVCAQDGVRGNVDLAYVLDAEPCGHCLIINNVNFSSTSGLSARNGS
NIDCAKLQHRFCSLHFTVEVKPDLTAKEMLLALAELAQRDHSALDCCVVVILSHGCQASH
LQFPGAVYGTDGYPVPVERVVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASACP
EDRTSGHNLEPDATPFQGGPRTSDDQVDAVSSLPTPSDILVSYSTFPGFVSWRDPKSGSW
YVETLDHILGRWAPTEDLQSLLLRVANAVSERGIYKQIPGCFNFLRKKLFFKT
Download sequence
Identical sequences G1TAS5
9986.ENSOCUP00000013793 ENSOCUP00000013793 ENSOCUP00000013793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]