SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014294 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014294
Domain Number 1 Region: 482-585
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 66-172
Classification Level Classification E-value
Superfamily SRCR-like 7.72e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 197-300
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000082
Further Details:      
 
Domain Number 4 Region: 364-458
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014294   Gene: ENSOCUG00000016629   Transcript: ENSOCUT00000016626
Sequence length 586
Comment pep:novel chromosome:oryCun2:6:26679839:26687303:1 gene:ENSOCUG00000016629 transcript:ENSOCUT00000016626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPLMGPPAGWTHGDAEARMGPQLDERTPAWRPGDGGAAPSPLPPALSFLLLLPLASALQ
PTPLPFPELRLVGGPSRCRGRLEVLHDGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGRGPILLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCEEFLPSQYATRR
ALTSSAPPPSLQNGRDEGSVRLAGGAGPCQGRVEILHAGVWGTVCDDDWGLPDAAVVCRQ
LGCGAALAATTNAFFGYGTGHILLDNVHCEGVEPQLAGCSSLGWGVHNCGHHEDAGVFCA
VLDPATPTAPPPSATRDDSAWHTERAATRGGAQPSGETASLTTAAWAAGRKSKYLARSRS
PQPSPSGRGEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLL
DNVGCTGTEARLSDCFHLGWGQHNCGHHEDAGALCAELGPDELVQQEGSETTRVPTPRPR
DGHLRLANGAHRCEGRVELFLGQQWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFG
PGRGPILLDNVKCRGDESTLLLCSHIRWDAHNCDHGEDAGVLCRPL
Download sequence
Identical sequences 9986.ENSOCUP00000014294 ENSOCUP00000014294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]